DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18476 and IKZF3

DIOPT Version :9

Sequence 1:	NP_731615.1	Gene:	CG18476 / 41404	FlyBaseID:	FBgn0037931	Length:	936	Species:	Drosophila melanogaster
Sequence 2:	NP_036613.2	Gene:	IKZF3 / 22806	HGNCID:	13178	Length:	509	Species:	Homo sapiens

Alignment Length:	149	Identity:	54/149 - (36%)
Similarity:	80/149 - (53%)	Gaps:	17/149 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   765 RLNNHIRDVHINGDRKRKEAIKRFLCSLCGMETRSAAALVTHMRRHTGEKPFKCDLCEMAFPRHS 829
            :|..|:    ::.|..|..:.| ..|.:||:...|...|:.|.|.||||:||:|:.|..:|.:..
Human   100 KLERHV----VSFDSSRPTSGK-MNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKG 159

  Fly   830 ELASHRRMHTGEKPFHCTVCGKDFARSDKLKRHMLTHSGLKPHKCTYCEKSYRQAKDLKLHLQQH 894
            .|..|.::|||||||.|.:|.....|.|.|..|:.|||..||:||.:|.:||:|...|:.|.::
Human   160 NLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKER- 223

  Fly   895 TGECPFVCGTCGERFIQSS 913
                   |.|    |:||:
Human   224 -------CRT----FLQST 231

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18476	NP_731615.1	zf-AD	6..84	CDD:285071
		C2H2 Zn finger	206..227	CDD:275368
		C2H2 Zn finger	236..256	CDD:275368
		C2H2 Zn finger	401..422	CDD:275368
		C2H2 Zn finger	431..447	CDD:275368
		C2H2 Zn finger	461..481	CDD:275368
		C2H2 Zn finger	490..511	CDD:275368
		C2H2 Zn finger	520..540	CDD:275368
		C2H2 Zn finger	638..659	CDD:275368
		C2H2 Zn finger	668..690	CDD:275368
		C2H2 Zn finger	698..715	CDD:275368
		C2H2 Zn finger	753..774	CDD:275368	2/8 (25%)
		C2H2 Zn finger	790..810	CDD:275368	7/19 (37%)
		zf-H2C2_2	802..825	CDD:290200	11/22 (50%)
		COG5048	814..>886	CDD:227381	31/71 (44%)
		C2H2 Zn finger	818..838	CDD:275368	5/19 (26%)
		zf-H2C2_2	830..855	CDD:290200	11/24 (46%)
		C2H2 Zn finger	846..866	CDD:275368	6/19 (32%)
		zf-H2C2_2	859..883	CDD:290200	12/23 (52%)
		C2H2 Zn finger	874..894	CDD:275368	7/19 (37%)
		C2H2 Zn finger	902..924	CDD:275368	5/12 (42%)
IKZF3	NP_036613.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..86
		COG5048	<79..>219	CDD:227381	48/123 (39%)
		C2H2 Zn finger	120..140	CDD:275368	7/19 (37%)
		zf-H2C2_2	133..157	CDD:316026	12/23 (52%)
		C2H2 Zn finger	148..168	CDD:275368	5/19 (26%)
		C2H2 Zn finger	176..196	CDD:275368	6/19 (32%)
		C2H2 Zn finger	204..220	CDD:275368	6/15 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	364..394
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910