Sequence 1: | NP_731615.1 | Gene: | CG18476 / 41404 | FlyBaseID: | FBgn0037931 | Length: | 936 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035901.1 | Gene: | Ikzf3 / 22780 | MGIID: | 1342542 | Length: | 507 | Species: | Mus musculus |
Alignment Length: | 142 | Identity: | 52/142 - (36%) |
---|---|---|---|
Similarity: | 74/142 - (52%) | Gaps: | 13/142 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 774 HINGDRKRKEAIKRFLCSLCGMETRSAAALVTHMRRHTGEKPFKCDLCEMAFPRHSELASHRRMH 838
Fly 839 TGEKPFHCTVCGKDFARSDKLKRHMLTHSGLKPHKCTYCEKSYRQAKDLKLHLQQHTGECPFVCG 903
Fly 904 TCGERFIQSSTL 915 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |