DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FPR1

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_014264.1 Gene:FPR1 / 855587 SGDID:S000005079 Length:114 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:49/91 - (53%)
Similarity:61/91 - (67%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELG 103
            |.||||.:||.|.|::|.:||||..||:||...:|..|||||||.||..:..||:.:||||....
Yeast    24 KTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYA 88

  Fly   104 YGASGAGGGKIPPNAVLVFDTELVKI 129
            ||..|. .|.||||:.||||.||:|:
Yeast    89 YGPRGF-PGLIPPNSTLVFDVELLKV 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 47/87 (54%)
FPR1NP_014264.1 FkpA <1..114 CDD:223619 49/91 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.