DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FPR2

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_010807.3 Gene:FPR2 / 852131 SGDID:S000002927 Length:135 Species:Saccharomyces cerevisiae


Alignment Length:133 Identity:71/133 - (53%)
Similarity:85/133 - (63%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILLICAFVAASAASDPKVKIGIKKR--VENCTRKAKGGDLVHVHYRGA-LQDGTEFDSSY 62
            |.....|.:..|....|.|...::|||.||  ||:|..||..||.|.|||.|: |:.||.|||||
Yeast     1 MMFNIYLFVTFFSTILAGSLSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTVFDSSY 65

  Fly    63 SRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELV 127
            |||:|.:|.||..:||||||||:.|||.||:|||.||..|.||..|. .|.|||:|.||||.|||
Yeast    66 SRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGV-PGVIPPSADLVFDVELV 129

  Fly   128 KIE 130
            .::
Yeast   130 DVK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 57/93 (61%)
FPR2NP_010807.3 FkpA <39..132 CDD:223619 58/93 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I1292
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40604
Inparanoid 1 1.050 125 1.000 Inparanoid score I1279
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoFinder 1 1.000 - - FOG0004360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 1 1.100 - - LDO PTHR45779
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2113
SonicParanoid 1 1.000 - - X3083
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.