DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP15-2

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_199669.1 Gene:FKBP15-2 / 834915 AraportID:AT5G48580 Length:163 Species:Arabidopsis thaliana


Alignment Length:145 Identity:70/145 - (48%)
Similarity:89/145 - (61%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILLICAF-------VAASAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEF 58
            |.|.|.|.:..|       .|.......:::||:|.:.:.|..:|..||.:.|||||.|.|||.|
plant     5 MSLRYSLFLIFFSLISLQGFAKKTGDVSELQIGVKFKPKTCEVQAHKGDTIKVHYRGKLTDGTVF 69

  Fly    59 DSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFD 123
            |||:.||.||.|.||:.|||||||||:||.|.||:|||.||.:||||..|: ...||..|.|:||
plant    70 DSSFERGDPFEFKLGSGQVIKGWDQGLLGACVGEKRKLKIPAKLGYGEQGS-PPTIPGGATLIFD 133

  Fly   124 TELVKI-EPRSGSEE 137
            |||:.: |..:|.||
plant   134 TELIAVNEKPAGGEE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 56/92 (61%)
FKBP15-2NP_199669.1 FKBP_C 45..137 CDD:395196 56/92 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40604
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0004360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 1 1.100 - - O PTHR45779
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.