DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP15-2

DIOPT Version :10

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_199669.1 Gene:FKBP15-2 / 834915 AraportID:AT5G48580 Length:163 Species:Arabidopsis thaliana


Alignment Length:145 Identity:70/145 - (48%)
Similarity:89/145 - (61%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILLICAF-------VAASAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEF 58
            |.|.|.|.:..|       .|.......:::||:|.:.:.|..:|..||.:.|||||.|.|||.|
plant     5 MSLRYSLFLIFFSLISLQGFAKKTGDVSELQIGVKFKPKTCEVQAHKGDTIKVHYRGKLTDGTVF 69

  Fly    59 DSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFD 123
            |||:.||.||.|.||:.|||||||||:||.|.||:|||.||.:||||..|: ...||..|.|:||
plant    70 DSSFERGDPFEFKLGSGQVIKGWDQGLLGACVGEKRKLKIPAKLGYGEQGS-PPTIPGGATLIFD 133

  Fly   124 TELVKI-EPRSGSEE 137
            |||:.: |..:|.||
plant   134 TELIAVNEKPAGGEE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:459735 56/92 (61%)
FKBP15-2NP_199669.1 FKBP_C 45..137 CDD:459735 56/92 (61%)

Return to query results.
Submit another query.