DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP53

DIOPT Version :10

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_567717.1 Gene:FKBP53 / 828637 AraportID:AT4G25340 Length:477 Species:Arabidopsis thaliana


Alignment Length:96 Identity:50/96 - (52%)
Similarity:65/96 - (67%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RKAKGGDLVHVHYRGALQ-DGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIP 99
            ::|..|..|.|.|.|.|| :|..|||:..: :||.|.||...||||||.|:.||..|::||||||
plant   384 KRADPGKTVSVRYIGKLQKNGKIFDSNIGK-SPFKFRLGIGSVIKGWDVGVNGMRVGDKRKLTIP 447

  Fly   100 PELGYGASGAGGGKIPPNAVLVFDTELVKIE 130
            |.:|||..|| ||:||||:.|.||.||:.::
plant   448 PSMGYGVKGA-GGQIPPNSWLTFDVELINVQ 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:459735 49/91 (54%)
FKBP53NP_567717.1 NPL 3..96 CDD:465511
FKBP_C 384..474 CDD:459735 49/91 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.