DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP15-1

DIOPT Version :10

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_566762.1 Gene:FKBP15-1 / 822115 AraportID:AT3G25220 Length:153 Species:Arabidopsis thaliana


Alignment Length:132 Identity:66/132 - (50%)
Similarity:84/132 - (63%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLICAFVAASAASD-PKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFS 69
            :|.|.....|..:.| .:::||:|.:.:.|..:|..||.:.|||||.|.|||.||||:.||.|..
plant    16 LLTILTLAYAKKSGDVTELQIGVKYKPQKCDLQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIE 80

  Fly    70 FTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSG 134
            |.||..|||.|||||:||.|.||:|||.||.:||||.:|: ..|||..|.|:||||||.:.....
plant    81 FELGTGQVIPGWDQGLLGACVGEKRKLKIPSKLGYGDNGS-PPKIPGGATLIFDTELVAVNGEPS 144

  Fly   135 SE 136
            ||
plant   145 SE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:459735 55/92 (60%)
FKBP15-1NP_566762.1 FkpA 48..139 CDD:440311 56/91 (62%)

Return to query results.
Submit another query.