DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and AT3G12340

DIOPT Version :10

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_187840.7 Gene:AT3G12340 / 820412 AraportID:AT3G12340 Length:499 Species:Arabidopsis thaliana


Alignment Length:122 Identity:45/122 - (36%)
Similarity:59/122 - (48%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIKKRVENCT-----------------RKAKGGDLVHVHYRGALQD-GTEFDSSYSRGTPFSFTL 72
            |.||.:|..|                 :.|..|..|.:.|.|.|:| |..|||:... .|..|.|
plant   379 GTKKPLETRTLSNGVIIEDIEKGKLDGKSAVKGKKVSILYTGKLKDTGNLFDSNLGE-DPLRFRL 442

  Fly    73 GARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKI 129
            |...||:|...|:.||..|::|:|.|||.|||...|. ..|:|.:|.||::.|.|||
plant   443 GGENVIEGLSIGVEGMRVGDKRRLIIPPALGYSKRGL-KEKVPKSAWLVYEVEAVKI 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:459735 38/110 (35%)
AT3G12340NP_187840.7 NPL 3..96 CDD:465511
FkpA 393..498 CDD:440311 38/106 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.