DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp10a

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_009292452.1 Gene:fkbp10a / 799903 ZFINID:ZDB-GENE-100921-75 Length:563 Species:Danio rerio


Alignment Length:122 Identity:47/122 - (38%)
Similarity:73/122 - (59%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLICAFVAASAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSF 70
            :||:..|   :...|  :.:.::...:.|.|||..||.:..||....||||.|||||:|.:.::.
Zfish   237 VLLVDLF---NVKDD--INVEVQMIPQPCRRKAVLGDFIRYHYNATFQDGTIFDSSYARNSTYNT 296

  Fly    71 TLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELV 127
            .:|...||.|.|:.:.|:|.||.|::|:||.|.||.:|: |..||.:|||:||..::
Zfish   297 FIGMGHVIAGIDKALQGVCVGEWRRVTVPPHLAYGETGS-GELIPGSAVLIFDMHII 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 43/92 (47%)
fkbp10aXP_009292452.1 FKBP_C 35..128 CDD:306713
FKBP_C 148..240 CDD:306713 1/2 (50%)
FKBP_C 260..352 CDD:306713 43/92 (47%)
FKBP_C 372..463 CDD:306713
EFh_CREC 490..>562 CDD:330175
EF-hand motif 526..554 CDD:320021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.