DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP7

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_851939.1 Gene:FKBP7 / 51661 HGNCID:3723 Length:222 Species:Homo sapiens


Alignment Length:120 Identity:55/120 - (45%)
Similarity:74/120 - (61%) Gaps:5/120 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGAL-QDGTEF--DSSYSRGTPFSFTLGARQVIKG 80
            |..:|||.:..|.|||::.:|.|||::.||.|.| :||::|  ..:.:.|.|..|.||..|||||
Human    31 STEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKG 95

  Fly    81 WDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIE--PRS 133
            .|..:..||.||:||:.|||...||..|...|||||:|.|:|:.||..:.  |||
Human    96 LDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 44/95 (46%)
FKBP7NP_851939.1 FKBP_C 46..141 CDD:306713 43/94 (46%)
EF-hand_7 152..214 CDD:316058
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222
Retention in the endoplasmic reticulum. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 219..222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.