DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp7

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001107676.1 Gene:fkbp7 / 496687 XenbaseID:XB-GENE-977646 Length:218 Species:Xenopus tropicalis


Alignment Length:144 Identity:59/144 - (40%)
Similarity:77/144 - (53%) Gaps:15/144 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTYILLICAFVAASAAS--------DPKVKIGIKKRVENCTRKAKGGDLVHVHYRGAL-QDGTEF 58
            ||::..:.||:..:..|        :.:|||.:......|.:|:|.||||:.||...| .:.|:.
 Frog     5 LTFLCFLQAFILLTVFSAEQKTDNEEEQVKIEVLHLPSECKQKSKKGDLVNAHYDAFLAHNMTKL 69

  Fly    59 DSSYSR--GTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLV 121
            ..|.|.  |.|..|.||..|||||.|..::.||.||:||..|||.|.||.  .|..||||||.|:
 Frog    70 YCSRSSADGHPKWFVLGVGQVIKGLDMALMDMCSGEKRKAIIPPSLAYGQ--RGHDKIPPNATLI 132

  Fly   122 FDTELVKIE--PRS 133
            |:.||..|.  |||
 Frog   133 FEIELYGITRGPRS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 46/95 (48%)
fkbp7NP_001107676.1 FKBP_C 44..137 CDD:365980 45/94 (48%)
EFh_CREC 152..>216 CDD:330175
EF-hand motif 177..216 CDD:320021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.