DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp2

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001004677.2 Gene:fkbp2 / 447939 ZFINID:ZDB-GENE-040912-126 Length:138 Species:Danio rerio


Alignment Length:137 Identity:76/137 - (55%)
Similarity:95/137 - (69%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILLI----CAFVAASAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSS 61
            |:|..:|.:    ........|...|::|||||||:||..|::.||::::||.|.|:||||||||
Zfish     1 MRLNLLLAVTLVSIPMALVQGAEKKKLQIGIKKRVDNCPIKSRKGDVLNMHYTGKLEDGTEFDSS 65

  Fly    62 YSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTEL 126
            ..|..||:||||..|||||||||:|||||||:|||.||.|||||..|| ..|||..|.|:|:.||
Zfish    66 IPRNQPFTFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGDRGA-PPKIPGGATLIFEVEL 129

  Fly   127 VKIEPRS 133
            :.||.||
Zfish   130 LNIERRS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 58/92 (63%)
fkbp2NP_001004677.2 FKBP_C 38..130 CDD:278674 58/92 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580224
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40604
Inparanoid 1 1.050 150 1.000 Inparanoid score I4349
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0004360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 1 1.100 - - LDO PTHR45779
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2113
SonicParanoid 1 1.000 - - X3083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.