DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp9

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001003520.1 Gene:fkbp9 / 445126 ZFINID:ZDB-GENE-040801-23 Length:564 Species:Danio rerio


Alignment Length:121 Identity:56/121 - (46%)
Similarity:76/121 - (62%) Gaps:3/121 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DPKVKIGIKKRV--ENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWD 82
            :||.:|.:|...  :.|.||::.||.:..||.|:|.|||.|||||||...:...:|...||.|.|
Zfish   248 NPKDEIAVKVEYLPDPCPRKSQVGDFMRYHYNGSLLDGTFFDSSYSRNHTYDTYIGKGYVIAGMD 312

  Fly    83 QGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSGSEEL 138
            ||:||:|.||:|::||||.|.||..|. |.|||.:||||||..::.....|.:.|:
Zfish   313 QGLLGVCVGERRRITIPPHLAYGEEGT-GTKIPGSAVLVFDVHIIDFHNPSDTVEI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 50/92 (54%)
fkbp9NP_001003520.1 FKBP_C 40..132 CDD:278674
FKBP_C 152..244 CDD:278674
FKBP_C 264..356 CDD:278674 50/92 (54%)
FKBP_C 375..467 CDD:278674
EF-hand_7 488..552 CDD:290234
EFh 490..551 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.