DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp14

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001003471.1 Gene:fkbp14 / 445077 ZFINID:ZDB-GENE-040801-210 Length:211 Species:Danio rerio


Alignment Length:127 Identity:63/127 - (49%)
Similarity:84/127 - (66%) Gaps:7/127 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FVAASAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQ-DGTEFDSSYSRG--TPFSFTLG 73
            :|..:...:|:|||.:..:...|.||:|.||::.|||.|.|: :||.|.||..:|  .|..||||
Zfish    16 YVHGAKLPEPEVKIEVLYKPFLCHRKSKYGDILLVHYDGFLESNGTMFHSSRHQGDKNPVWFTLG 80

  Fly    74 ARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIE--PRS 133
            .|:||||||:|:..||.||:|||||||.|.||..|.  |||||.:.|:||.|:::|.  |||
Zfish    81 IREVIKGWDKGLQNMCAGEKRKLTIPPALAYGKEGK--GKIPPESTLIFDIEIIEIRNGPRS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 54/95 (57%)
fkbp14NP_001003471.1 FKBP_C 38..132 CDD:278674 54/95 (57%)
EF-hand_7 141..204 CDD:290234 63/127 (50%)
EFh 142..204 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.