DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp39

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster


Alignment Length:113 Identity:51/113 - (45%)
Similarity:64/113 - (56%) Gaps:4/113 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AASDPKVKIGIKKRVENCTRK---AKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVI 78
            |:.||:...|..|.|:....|   ||.|..|.|:|.|.||...:...|..:|.||.|.||..:||
  Fly   242 ASKDPRTITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVI 306

  Fly    79 KGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTEL 126
            ||||.|:.||..|.:|.:|.||.:.|||.|| ..||.||:.|||:.||
  Fly   307 KGWDVGVAGMKVGGKRVITCPPHMAYGARGA-PPKIGPNSTLVFEVEL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 45/96 (47%)
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 45/93 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.