DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp14

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster


Alignment Length:133 Identity:67/133 - (50%)
Similarity:87/133 - (65%) Gaps:5/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILLICAFVAA---SAASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQ-DGTEFDSS 61
            |..:.:::.|..:.|   |......:|:.:....|.|.:|:|.||.:.:||.|.|| ||.:||||
  Fly     1 MSKSNLVISCLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSS 65

  Fly    62 YSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTEL 126
            :.|..||:|.|||.|||||||||:|.||.||:|||||||:||||..|| |..|||.|.|:||.||
  Fly    66 FDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGA-GNVIPPKATLLFDVEL 129

  Fly   127 VKI 129
            :.|
  Fly   130 INI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 59/93 (63%)
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 59/93 (63%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I407
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9748
orthoMCL 1 0.900 - - OOG6_101705
Panther 1 1.100 - - P PTHR45779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.