DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp12

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:92 Identity:46/92 - (50%)
Similarity:60/92 - (65%) Gaps:1/92 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELG 103
            |.|..|.|||.|.|.|||:||||..|..||.||:|..:||:|||:|:..:..|::.||...|:..
  Fly    18 KNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYA 82

  Fly   104 YGASGAGGGKIPPNAVLVFDTELVKIE 130
            ||:.| ..|.||||:.|.||.||:|:|
  Fly    83 YGSRG-HPGVIPPNSTLTFDVELLKVE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 43/87 (49%)
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 44/89 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452518
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I366
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9748
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.