DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp3

DIOPT Version :10

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001071238.1 Gene:fkbp3 / 368863 ZFINID:ZDB-GENE-030616-419 Length:220 Species:Danio rerio


Alignment Length:117 Identity:47/117 - (40%)
Similarity:65/117 - (55%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSSY-------SRGTPFSFTLGARQVI 78
            ||....|.|:.:. |...|.|:.|...|.|.|:|||.||::.       .:..|.||.:|..:||
Zfish   105 PKFTKSILKKGDK-TNFPKKGETVSCWYTGTLEDGTVFDTNIPATAKKKKQSKPLSFKVGMGKVI 168

  Fly    79 KGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIE 130
            :|||:|:|.|.:||..:|.|..|..||..|....||||||.|:|:.|||.::
Zfish   169 RGWDEGLLTMSKGETARLEIESEWAYGKKGLPDAKIPPNAKLIFEVELVAVD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:459735 41/99 (41%)
fkbp3NP_001071238.1 BTHB_FKBP25 6..72 CDD:439139
FKBP_C 120..217 CDD:459735 40/96 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.