DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp7

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001004506.1 Gene:fkbp7 / 368498 ZFINID:ZDB-GENE-030616-182 Length:219 Species:Danio rerio


Alignment Length:149 Identity:58/149 - (38%)
Similarity:84/149 - (56%) Gaps:18/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILLICAFVAASA-----------ASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGAL-Q 53
            |.|.::...|..::..|           .::..|||.:....|||::|||.||:::.||.|.| :
Zfish     1 MFLRFLFYFCLILSLQALYPFITIIRANETNEDVKIEVTFLPENCSQKAKRGDMLNAHYDGFLAK 65

  Fly    54 DGTEFDSSYS--RGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPP 116
            ||::|..|.:  :|.|..|.||...:|||.|..:..||.||:||:||||.|.||..  |.|.:||
Zfish    66 DGSQFYCSRTTEKGHPHWFVLGVGNIIKGLDVALQDMCPGEKRKVTIPPSLAYGEK--GNGPVPP 128

  Fly   117 NAVLVFDTELVKIE--PRS 133
            ||.::|:.||:.|.  |||
Zfish   129 NATVIFEVELLHISRGPRS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 44/95 (46%)
fkbp7NP_001004506.1 FKBP_C 45..139 CDD:278674 44/95 (46%)
EF-hand_7 149..211 CDD:290234
EFh 149..210 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.