DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp10

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_038942330.1 Gene:Fkbp10 / 360627 RGDID:1549751 Length:620 Species:Rattus norvegicus


Alignment Length:125 Identity:53/125 - (42%)
Similarity:77/125 - (61%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YILLICAFVAASAASDPK--VKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTP 67
            |:|||       ...:||  |::...:..::|.|:|..||.:..||.|:|.|||.|||||||...
  Rat   293 YVLLI-------DVHNPKDTVQLETLELPQDCVRRAVAGDFMRYHYNGSLMDGTLFDSSYSRNHT 350

  Fly    68 FSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELV 127
            ::..:|...:|.|.|||:.|.|.||:|::|:||.|.||.:|. |.|||.:|||:||..::
  Rat   351 YNTYVGQGYIIPGMDQGLQGACIGERRRITVPPHLAYGENGT-GDKIPGSAVLIFDVHVI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 46/92 (50%)
Fkbp10XP_038942330.1 FKBP_C 54..146 CDD:395196
FKBP_C 166..297 CDD:395196 2/3 (67%)
FKBP_C 317..409 CDD:395196 46/92 (50%)
FKBP_C 430..521 CDD:395196
EFh 544..605 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.