DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14715 and Fkbp15

DIOPT Version :9

Sequence 1:	NP_650101.1	Gene:	CG14715 / 41403	FlyBaseID:	FBgn0037930	Length:	138	Species:	Drosophila melanogaster
Sequence 2:	XP_006538097.1	Gene:	Fkbp15 / 338355	MGIID:	2444782	Length:	1255	Species:	Mus musculus

Alignment Length:	143	Identity:	44/143 - (30%)
Similarity:	67/143 - (46%)	Gaps:	30/143 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 KVKIGIKKRVENCTRK-----------------AKG-----GDLVHVHYRG-ALQD---GTEFDS 60
            |..:...|:|  |..|                 |:|     ||.:.|.|.| .||:   |..|||
Mouse   157 KAAVSFNKQV--CVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQNHVLGQVFDS 219

  Fly    61 SYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTE 125
            :.::..|....||:.:|:||.:.|:|||.:|.:|.:..|.....|:.|..|...|.:::|||:.|
Mouse   220 TANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGWTQPTDSILVFEVE 284

  Fly   126 L--VKIEPRSGSE 136
            :  ||....|||:
Mouse   285 VRRVKFARDSGSD 297

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14715	NP_650101.1	FKBP_C	34..127	CDD:278674	36/120 (30%)
Fkbp15	XP_006538097.1	FKBP_C	192..285	CDD:365980	31/92 (34%)
		PRK10263	<378..>489	CDD:236669
		Smc	<561..890	CDD:224117
		PHA03247	<944..1129	CDD:223021
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900