DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp4

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_005173673.1 Gene:fkbp4 / 321795 ZFINID:ZDB-GENE-030131-514 Length:450 Species:Danio rerio


Alignment Length:112 Identity:55/112 - (49%)
Similarity:66/112 - (58%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKVKIGIKKRVENCTRKAKG------GDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIK 79
            ||...|:.|.|:   ::..|      ||.|.|||.|.|.||::||||..||..|||.||..||||
Zfish    22 PKKDGGVLKLVK---KEGTGTELPMIGDKVFVHYVGTLLDGSQFDSSRDRGEKFSFELGKGQVIK 83

  Fly    80 GWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTEL 126
            .||.|:..|..||..:||..||..|||:|: ..||||||.|:|..||
Zfish    84 AWDIGVATMKIGEICQLTCKPEYAYGAAGS-PPKIPPNATLLFQVEL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 50/99 (51%)
fkbp4XP_005173673.1 FKBP_C 38..129 CDD:278674 48/91 (53%)
ppisom_GldI <153..249 CDD:132555
TPR repeat 269..293 CDD:276809
TPR_16 270..348 CDD:290168
TPR repeat 305..343 CDD:276809
TPR_11 316..379 CDD:290150
TPR_1 316..347 CDD:278916
TPR repeat 348..376 CDD:276809
TPR_1 349..381 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.