DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp11

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001013123.2 Gene:Fkbp11 / 300211 RGDID:1306161 Length:201 Species:Rattus norvegicus


Alignment Length:136 Identity:51/136 - (37%)
Similarity:73/136 - (53%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILLI----CAFVAASAASDPKVKIGIKKRV---ENCTRKAKGGDLVHVHYRGALQDGTEF 58
            ::|..:|||    |...|......|...:.::..|   |:||..|..||.:|:||.|:|.||...
  Rat    10 LRLLLLLLISGAVCQAEAEVETESPVRTLQVETLVQPPESCTESAAFGDTLHIHYTGSLADGRII 74

  Fly    59 DSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFD 123
            |:|.:| .|....||.:|||.|.:|.:|.||.||:|:..||..|.||..|. ...||.:||:.:|
  Rat    75 DTSLTR-DPLVIELGQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGKRGY-PPSIPADAVVQYD 137

  Fly   124 TELVKI 129
            .||:.:
  Rat   138 VELIAL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 41/92 (45%)
Fkbp11NP_001013123.2 FKBP_C 50..141 CDD:278674 41/92 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.