DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp3

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001100206.2 Gene:Fkbp3 / 299104 RGDID:1304992 Length:224 Species:Rattus norvegicus


Alignment Length:117 Identity:48/117 - (41%)
Similarity:66/117 - (56%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGT-------PFSFTLGARQVI 78
            ||....:.|:.:. |...|.||:||..|.|.|.|||.||::....:       |.||.:|..:||
  Rat   109 PKYTKSVLKKGDK-TNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVI 172

  Fly    79 KGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIE 130
            :|||:.:|.|.:||:.:|.|.||..||..|....|||||..|:|:.|||.|:
  Rat   173 RGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 42/99 (42%)
Fkbp3NP_001100206.2 BTHB 6..76 CDD:408209
FKBP_C 124..221 CDD:395196 41/96 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.