DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp7

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001099955.2 Gene:Fkbp7 / 295672 RGDID:1305293 Length:218 Species:Rattus norvegicus


Alignment Length:120 Identity:56/120 - (46%)
Similarity:76/120 - (63%) Gaps:5/120 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGAL-QDGTEFDSSYSR--GTPFSFTLGARQVIKG 80
            |..:|||.:..|.|||::.::.|||::.||.|.| :||::|..|.::  |.|..|.||...||||
  Rat    27 STEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKG 91

  Fly    81 WDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIE--PRS 133
            .|..::.||.||:||:.|||.|.||..|...|||||||.|:|:.||..:.  |||
  Rat    92 LDIAMMDMCPGEKRKVIIPPSLAYGKEGYAEGKIPPNATLMFEIELYAVTKGPRS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 45/95 (47%)
Fkbp7NP_001099955.2 FKBP_C 42..137 CDD:278674 44/94 (47%)
EF-hand_7 148..210 CDD:290234
EFh 148..209 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.