DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp1a

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_037234.2 Gene:Fkbp1a / 25639 RGDID:2617 Length:108 Species:Rattus norvegicus


Alignment Length:92 Identity:48/92 - (52%)
Similarity:63/92 - (68%) Gaps:1/92 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELG 103
            |.|....|||.|.|:||.:||||..|..||.||||.::||:||::|:..|..|::.||.|.|:..
  Rat    18 KRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISPDYA 82

  Fly   104 YGASGAGGGKIPPNAVLVFDTELVKIE 130
            |||:| ..|.|||:|.||||.||:|:|
  Rat    83 YGATG-HPGIIPPHATLVFDVELLKLE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 45/87 (52%)
Fkbp1aNP_037234.2 FkpA <2..106 CDD:223619 46/88 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.