DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkh1

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_595257.1 Gene:fkh1 / 2541195 PomBaseID:SPBC839.17c Length:112 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:51/111 - (45%)
Similarity:71/111 - (63%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IGIKKRV---ENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGIL 86
            :|::|:|   .|.....|.||.:.:||.|.|.:|.:||||..||:||..|:|..|:|:|||:|:.
pombe     1 MGVEKQVISSGNGQDFPKPGDRITMHYTGTLTNGKKFDSSVDRGSPFVCTIGVGQLIRGWDEGVP 65

  Fly    87 GMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIEPR 132
            .|..||:.||||.|:.|||..|. .|.||||:.|:||.||:.|..:
pombe    66 KMSLGEKAKLTITPDYGYGPRGF-PGLIPPNSTLLFDVELLAINDK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 45/92 (49%)
fkh1NP_595257.1 FkpA <2..108 CDD:223619 50/106 (47%)
FKBP_C 13..105 CDD:278674 45/92 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.