DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14715 and FKBP15

DIOPT Version :9

Sequence 1:	NP_650101.1	Gene:	CG14715 / 41403	FlyBaseID:	FBgn0037930	Length:	138	Species:	Drosophila melanogaster
Sequence 2:	NP_056073.1	Gene:	FKBP15 / 23307	HGNCID:	23397	Length:	1219	Species:	Homo sapiens

Alignment Length:	102	Identity:	38/102 - (37%)
Similarity:	56/102 - (54%)	Gaps:	6/102 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    41 GDLVHVHYRGALQD----GTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPE 101
            ||.:.|.|.|.|..    |..|||:.::.......||:.:|||||:.|:|||.:|.:|.|.:||.
Human   197 GDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKGWEDGMLGMKKGGKRLLIVPPA 261

  Fly   102 LGYGASGAGGGKIPPNAVLVFDTEL--VKIEPRSGSE 136
            ...|:.|..|.....:::|||:.|:  ||....|||:
Human   262 CAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSD 298

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14715	NP_650101.1	FKBP_C	34..127	CDD:278674	33/91 (36%)
FKBP15	NP_056073.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	41..66
		PH-like	70..168	CDD:302622
		Important for function in growth cone organization. /evidence=ECO:0000250	72..169
		FKBP_C	193..286	CDD:278674	32/88 (36%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	294..349		3/5 (60%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	381..433
		COG1340	511..781	CDD:224259
		TIMELESS_C	589..>777	CDD:252956
		SPEC	686..908	CDD:295325
		DUF4515	694..871	CDD:291649
		Ax_dynein_light	<715..780	CDD:287215
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	739..761
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	931..1219
		Extradiol_Dioxygenase_3B_like	<1014..>1072	CDD:294399
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810