DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp14

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_705801.1 Gene:Fkbp14 / 231997 MGIID:2387639 Length:211 Species:Mus musculus


Alignment Length:134 Identity:66/134 - (49%)
Similarity:90/134 - (67%) Gaps:8/134 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLICAFVAASA-ASDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQ-DGTEFDSS--YSRGT 66
            ||.:...|.:.| ..:|:|||.:.::...|.||.|||||:.|||.|.|: ||:.|.|:  ::.|.
Mouse     9 ILALWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQ 73

  Fly    67 PFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIE- 130
            |..||||..:|:||||||:.|||.||:||||:||.||||..|.  |||||.:.|:|:.:|::|. 
Mouse    74 PVWFTLGILEVLKGWDQGLKGMCVGEKRKLTVPPALGYGKEGK--GKIPPESTLIFNIDLLEIRN 136

  Fly   131 -PRS 133
             |||
Mouse   137 GPRS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 53/95 (56%)
Fkbp14NP_705801.1 FKBP_C 38..132 CDD:278674 53/95 (56%)
EF-hand_7 141..204 CDD:290234 66/134 (49%)
EFh 142..204 CDD:298682
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 208..211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.