DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP5

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001139247.1 Gene:FKBP5 / 2289 HGNCID:3721 Length:457 Species:Homo sapiens


Alignment Length:101 Identity:49/101 - (48%)
Similarity:62/101 - (61%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEG 91
            |.|||.|.......||.|:|||:|.|.:|.:||||:.|..||.|:||..||||.||.|:..|.:|
Human    36 IVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKG 100

  Fly    92 EQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELV 127
            |...|...||..||::|: ..|||.||.|.|:.||:
Human   101 EICHLLCKPEYAYGSAGS-LPKIPSNATLFFEIELL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 43/92 (47%)
FKBP5NP_001139247.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..135 CDD:278674 43/92 (47%)
TPR_11 267..347 CDD:290150
TPR 1 268..301
TPR repeat 268..296 CDD:276809
TPR 2 317..350
TPR_11 319..382 CDD:290150
TPR 319..350 CDD:197478
TPR repeat 319..345 CDD:276809
TPR repeat 350..380 CDD:276809
TPR 3 351..384
TPR_1 352..384 CDD:278916
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.