DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP2

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001357294.1 Gene:FKBP2 / 2286 HGNCID:3718 Length:171 Species:Homo sapiens


Alignment Length:141 Identity:77/141 - (54%)
Similarity:100/141 - (70%) Gaps:9/141 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTY-----ILLICAFVAASAA---SDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTE 57
            |:|::     :|.||....|:|.   ...|::||:||||::|..|::.||::|:||.|.|:||||
Human    30 MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTE 94

  Fly    58 FDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVF 122
            ||||..:..||.|:||..|||||||||:|||||||:|||.||.|||||..|| ..|||..|.|||
Human    95 FDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGA-PPKIPGGATLVF 158

  Fly   123 DTELVKIEPRS 133
            :.||:|||.|:
Human   159 EVELLKIERRT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 58/92 (63%)
FKBP2NP_001357294.1 FKBP_C 71..163 CDD:333962 58/92 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40604
Inparanoid 1 1.050 148 1.000 Inparanoid score I4400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0004360
OrthoInspector 1 1.000 - - oto88605
orthoMCL 1 0.900 - - OOG6_101705
Panther 1 1.100 - - LDO PTHR45779
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2113
SonicParanoid 1 1.000 - - X3083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.