DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkb-1

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001255531.1 Gene:fkb-1 / 191634 WormBaseID:WBGene00001426 Length:139 Species:Caenorhabditis elegans


Alignment Length:140 Identity:79/140 - (56%)
Similarity:97/140 - (69%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYIL-LICAFVAASAASDPKV---KIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSS 61
            ||...|: |:|....|.||.:.|:   :||:|||.|||.:|::.||.:|:||.|.|.||||||||
 Worm     1 MKTAVIVGLLCLLAIAYAADEQKIDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTLLDGTEFDSS 65

  Fly    62 YSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTEL 126
            .:|...|:||||...||||||||:|.||.||:|.|||||.||||..|| ..|||.|:||.||.||
 Worm    66 RTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGA-PPKIPGNSVLKFDVEL 129

  Fly   127 VKIEPRSGSE 136
            :||: |.|.|
 Worm   130 MKID-RDGEE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 57/92 (62%)
fkb-1NP_001255531.1 FKBP_C 38..129 CDD:278674 56/91 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40604
Inparanoid 1 1.050 147 1.000 Inparanoid score I3001
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0004360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2113
SonicParanoid 1 1.000 - - X3083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.