DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkb-3

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001379619.1 Gene:fkb-3 / 179113 WormBaseID:WBGene00001428 Length:261 Species:Caenorhabditis elegans


Alignment Length:120 Identity:60/120 - (50%)
Similarity:75/120 - (62%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPKVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQ 83
            :|..|.|.|...||.||.||:.||.:|..|...|:||:..|||:||..||.|.:|:.|||||.|.
 Worm   144 TDEGVHIHITHEVEGCTEKAQAGDTLHQQYTLNLEDGSFIDSSWSRNRPFIFKMGSGQVIKGMDI 208

  Fly    84 GILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSGSEEL 138
            .:.|||:||:||:.|||||.||.:|.... ||.|:.|.||..|.|: .|.|.|||
 Worm   209 AMEGMCQGEKRKVVIPPELAYGENGRPPA-IPGNSYLHFDLSLEKL-VRPGKEEL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 47/92 (51%)
fkb-3NP_001379619.1 FkpA 55..250 CDD:223619 53/106 (50%)
FKBP_C 159..250 CDD:395196 47/91 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.