DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkb-8

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001021725.1 Gene:fkb-8 / 173159 WormBaseID:WBGene00001433 Length:290 Species:Caenorhabditis elegans


Alignment Length:112 Identity:46/112 - (41%)
Similarity:61/112 - (54%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LICAFVAASAASDPKVKIGIKKRV----ENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPF 68
            |.|.....:.:.|...|||:.:::    :|.| |:|.|..|..||...|.|||:.|||..|.|||
 Worm   180 LTCKVRLFNCSWDSYAKIGVDRQILVQGDNVT-KSKNGQTVTCHYVLILVDGTKIDSSRDRETPF 243

  Fly    69 SFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIP 115
            .|.:|..:||||||||:..|...|:.||||.|..|:..     ||:|
 Worm   244 KFKIGKGEVIKGWDQGVAQMSVKEKSKLTIAPAFGFEK-----GKLP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 39/82 (48%)
fkb-8NP_001021725.1 FKBP_C 99..186 CDD:278674 2/5 (40%)
FKBP_C 211..290 CDD:278674 39/81 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.