DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp8

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001104536.1 Gene:Fkbp8 / 14232 MGIID:1341070 Length:403 Species:Mus musculus


Alignment Length:104 Identity:31/104 - (29%)
Similarity:46/104 - (44%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYG 105
            |.:|.||.:.:|::||.....    ...:||||...||:..|..:..|..||...:|...:..||
Mouse   110 GQVVTVHLQMSLENGTRVQEE----PELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG 170

  Fly   106 ASGAGGGKIPPNAVLVFDTEL------VKIEPRSGSEEL 138
            ..|:....|||:|.|..:..|      ..:|..||.|.:
Mouse   171 PQGSRSPYIPPHAALCLEVTLKTAEDGPDLEMLSGQERV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 27/91 (30%)
Fkbp8NP_001104536.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..54
FKBP_C 103..192 CDD:365980 26/85 (31%)
TPR <206..329 CDD:223533 1/4 (25%)
TPR 1 212..245
TPR repeat 245..292 CDD:276809
TPR 2 263..296
TPR 3 297..330
TPR repeat 297..325 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.