DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp4

DIOPT Version :10

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_034349.1 Gene:Fkbp4 / 14228 MGIID:95543 Length:458 Species:Mus musculus


Alignment Length:123 Identity:55/123 - (44%)
Similarity:69/123 - (56%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKVKIGIKKRVENCTRKAKG------GDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIK 79
            ||...|:.|.::   |:..|      ||.|.|||.|.|.|||:||||..|...|||.||..:|||
Mouse    27 PKQDEGVLKVIK---REGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIK 88

  Fly    80 GWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSGSEE 137
            .||..:..|..||...:|..||..|||:|: ..||||||.|||:.||.:.:....:||
Mouse    89 AWDIAVATMKVGEVCHITCKPEYAYGAAGS-PPKIPPNATLVFEVELFEFKGEDLTEE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:459735 48/98 (49%)
Fkbp4NP_034349.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..134 CDD:459735 46/91 (51%)
NlpI 215..424 CDD:443815
Interaction with tubulin. /evidence=ECO:0000250 267..400
TPR repeat 274..301 CDD:276809
TPR repeat 306..348 CDD:276809
TPR repeat 353..381 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..458
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.