DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp4

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_034349.1 Gene:Fkbp4 / 14228 MGIID:95543 Length:458 Species:Mus musculus


Alignment Length:123 Identity:55/123 - (44%)
Similarity:69/123 - (56%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKVKIGIKKRVENCTRKAKG------GDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIK 79
            ||...|:.|.::   |:..|      ||.|.|||.|.|.|||:||||..|...|||.||..:|||
Mouse    27 PKQDEGVLKVIK---REGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIK 88

  Fly    80 GWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSGSEE 137
            .||..:..|..||...:|..||..|||:|: ..||||||.|||:.||.:.:....:||
Mouse    89 AWDIAVATMKVGEVCHITCKPEYAYGAAGS-PPKIPPNATLVFEVELFEFKGEDLTEE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 48/98 (49%)
Fkbp4NP_034349.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..134 CDD:278674 46/91 (51%)
Interaction with tubulin. /evidence=ECO:0000250 267..400
TPR_11 274..349 CDD:290150
TPR repeat 274..301 CDD:276809
TPR repeat 306..348 CDD:276809
TPR_1 321..352 CDD:278916
TPR_11 322..384 CDD:290150
TPR repeat 353..381 CDD:276809
TPR_1 354..386 CDD:278916
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.