DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and Fkbp2

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001159840.1 Gene:Fkbp2 / 14227 MGIID:95542 Length:140 Species:Mus musculus


Alignment Length:139 Identity:81/139 - (58%)
Similarity:102/139 - (73%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTYILL---IC--AFVAASAASDP-KVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFD 59
            |:|::||.   ||  |..||:.|... |::||:||||::|..|::.||::|:||.|.|:||||||
Mouse     1 MRLSWILTILSICLSALAAATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFD 65

  Fly    60 SSYSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDT 124
            ||..:..||.|:||..|||||||||:|||||||:|||.||.|||||..|| ..|||..|.|||:.
Mouse    66 SSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGA-PPKIPGGATLVFEV 129

  Fly   125 ELVKIEPRS 133
            ||:|||.||
Mouse   130 ELLKIERRS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 58/92 (63%)
Fkbp2NP_001159840.1 FKBP_C 40..132 CDD:306713 58/92 (63%)
Prevents secretion from ER. /evidence=ECO:0000255 137..140 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40604
Inparanoid 1 1.050 152 1.000 Inparanoid score I4337
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53716
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0004360
OrthoInspector 1 1.000 - - oto92168
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45779
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2113
SonicParanoid 1 1.000 - - X3083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.970

Return to query results.
Submit another query.