DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and FKBP9

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001271270.1 Gene:FKBP9 / 11328 HGNCID:3725 Length:623 Species:Homo sapiens


Alignment Length:125 Identity:58/125 - (46%)
Similarity:75/125 - (60%) Gaps:4/125 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VAASAASDPKVKIGIKKRV--ENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGAR 75
            ||.....:||..|.|:.:|  |||.|.::.||.:..||.|.|.|||.|||||||...|...:|..
Human   301 VALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIGQG 365

  Fly    76 QVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELVKIEPRSGS 135
            .||.|.|:|:||:|.||:|::.:||.||||..|.  |.||.:||||||..::.....|.|
Human   366 YVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGR--GNIPGSAVLVFDIHVIDFHNPSDS 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 47/92 (51%)
FKBP9NP_001271270.1 FKBP_C 47..191 CDD:278674
FKBP_C 212..304 CDD:278674 2/2 (100%)
FKBP_C 324..415 CDD:278674 47/92 (51%)
FKBP_C 435..527 CDD:278674
EF-hand_7 548..612 CDD:290234
EFh 550..611 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.