DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp11

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_004921503.3 Gene:fkbp11 / 100491273 XenbaseID:XB-GENE-966311 Length:193 Species:Xenopus tropicalis


Alignment Length:133 Identity:49/133 - (36%)
Similarity:75/133 - (56%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YILLICAFVAASAASDP--------KVKIGIKKRVENCTRKAKGGDLVHVHYRGALQDGTEFDSS 61
            ::||:........|..|        ::.:...::.::||..|..||.:|:||.|.|:||...|||
 Frog     5 FVLLLLLTPPTLRAETPEEESENVTELVVETVEKPDSCTETADMGDTIHLHYTGRLEDGRIIDSS 69

  Fly    62 YSRGTPFSFTLGARQVIKGWDQGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTEL 126
            .|| .|....||.:|||.|.::.::|||.||:||:.|||.:.||..|. ...||.:|||.|:||:
 Frog    70 LSR-DPLVVELGKKQVIPGLEKSLVGMCVGEKRKMVIPPHMAYGKRGY-PPSIPGDAVLQFETEV 132

  Fly   127 VKI 129
            :.:
 Frog   133 MAL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 45/92 (49%)
fkbp11XP_004921503.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.