DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14715 and fkbp9

DIOPT Version :9

Sequence 1:NP_650101.1 Gene:CG14715 / 41403 FlyBaseID:FBgn0037930 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001123385.1 Gene:fkbp9 / 100125793 XenbaseID:XB-GENE-1019523 Length:585 Species:Xenopus tropicalis


Alignment Length:110 Identity:53/110 - (48%)
Similarity:72/110 - (65%) Gaps:4/110 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DPKVKIGIKKRV--ENCTRKAKGGDLVHVHYRGALQDGTEFDSSYSRGTPFSFTLGARQVIKGWD 82
            :||..|.::...  |:|.|:.:.||.:..||.|:|.|||.|||||||...:...:|...||.|.|
 Frog   268 NPKDSITVESHYVPEDCERRTQVGDFIRYHYNGSLLDGTLFDSSYSRKHTYDTYIGKGYVIAGMD 332

  Fly    83 QGILGMCEGEQRKLTIPPELGYGASGAGGGKIPPNAVLVFDTELV 127
            :|:||:|.||:|::||||.||||..|.  ||||.:||||||..::
 Frog   333 EGLLGLCTGEKRRVTIPPHLGYGEEGR--GKIPGSAVLVFDIHVI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14715NP_650101.1 FKBP_C 34..127 CDD:278674 49/92 (53%)
fkbp9NP_001123385.1 FKBP_C 60..152 CDD:365980
FKBP_C 172..264 CDD:365980
FKBP_C 284..375 CDD:365980 49/92 (53%)
FKBP_C 395..487 CDD:365980
EFh 510..571 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.