DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and PTP1

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:91/340 - (26%)
Similarity:130/340 - (38%) Gaps:101/340 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1128 VPPGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVR----GPRDAPNYYIACQAPLEST 1188
            :.|..:.:|||.|::|....||.|:....:|   ||||:||:    |....|.||||.|.|...|
Yeast    48 IEPRNDARNRYVNIMPYERNRVHLKTLSGND---YINASYVKVNVPGQSIEPGYYIATQGPTRKT 109

  Fly  1189 TSDFWRMIWEQ---QSRVIIQATDLSENGIERCAEYLP----------------PSATLDNHSSY 1234
            ...||:|.:..   .:.||:..|.|.|...|:|.:|.|                |....|.....
Yeast   110 WDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFP 174

  Fly  1235 GDYQVTLKH-REVKDRYAISTLVLKRVDGEESRELT-HYWY--KWPEAGVPAEEAPIIAMLLEAR 1295
            .|.::...: .:|||.|.::.:.|...|.......| |::|  .|.:...|.|..||:.:     
Yeast   175 SDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMEL----- 234

  Fly  1296 SSLKSYSLEQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSP 1360
                                               ...||.:|          |:..|:.||||.
Yeast   235 -----------------------------------CAHSHSLN----------SRGNPIIVHCSA 254

  Fly  1361 GTGRTGTIIASD------MAIRSLETPKRSVD----------IPQLVYYVRRGRASAVQTKEQYE 1409
            |.|||||.||.|      :..:::....|..|          |.|:|..:|..|...||||:|:.
Yeast   255 GVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFL 319

  Fly  1410 FIYKVASMYAAKITN 1424
            |||     :|||..|
Yeast   320 FIY-----HAAKYLN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 86/323 (27%)
Y_phosphatase 1134..1415 CDD:278528 86/323 (27%)
PTP1NP_010051.1 COG5599 1..335 CDD:227886 91/340 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.