DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and PTPN5

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_016873923.1 Gene:PTPN5 / 84867 HGNCID:9657 Length:719 Species:Homo sapiens


Alignment Length:462 Identity:111/462 - (24%)
Similarity:177/462 - (38%) Gaps:124/462 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   928 QPVEISLLDDS---TTTTTTTPAPPVYFESSTVA-----------STTIRSSTTMLPETTTASTQ 978
            ||:.:..||::   ..:....|.||.....|..|           |.|:|||..:.     |::|
Human    36 QPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQKPPPRGAGSHSLTVRSSLCLF-----AASQ 95

  Fly   979 SPSEMPPTFMAPYPNELDHMQTNA----------------QDNGT-DVNVIIAITVSVIGVVALI 1026
            ........:.:.|.:......||.                .|:|| .|..::.:.:|| |:|.:.
Human    96 FLLACGVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGTWGVPSLLLVFLSV-GLVLVT 159

  Fly  1027 LLVAFLYLMR------------------KRQKQTSYGQ--------------------------- 1046
            .||  .:|:|                  .||...:|.:                           
Human   160 TLV--WHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMD 222

  Fly  1047 ---RCRPVSLDAYSLDNVSVLGSVRRKGRDMR---------ASKRTYGNAAFD-DPSLRHNLLTA 1098
               ...|.||      .|..:|...|:|.::.         .::..:|..... :.|.|..||:|
Human   223 IKPEADPTSL------TVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSA 281

  Fly  1099 SELAR---FVERRSDVF---EEFRDVPQIIARADEVP-PGCEDKNRYANVIPLPETRVVLQRQGD 1156
            |.:.:   ..|:..|.|   .||.::|.......|.. ||...||||..::|.|.:||.|.....
Human   282 SRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDP 346

  Fly  1157 DDK-TEYINANYVRGPRDAPNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAE 1220
            ||. :.||||||:||.......|||.|.|:.||.:|||||:|::.:.:|:..|::.|.. |:|.|
Human   347 DDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMN-EKCTE 410

  Fly  1221 YLPPSATLDNHSSYGDYQVTLKHREVKDRYAISTLVLKRVDGEESRELTHYWYKWPEA------G 1279
            |.|     :...:|...::|::.....:.|.:..:.||..|.|: |.|..:.:..|.|      |
Human   411 YWP-----EEQVAYDGVEITVQKVIHTEDYRLRLISLKCRDWED-RLLHCHQHLLPAAAAGGCGG 469

  Fly  1280 VPAEEAP 1286
            .|.:..|
Human   470 HPEDHVP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 54/160 (34%)
Y_phosphatase 1134..1415 CDD:278528 54/160 (34%)
PTPN5XP_016873923.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D566624at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.