DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and PTP1

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001031266.1 Gene:PTP1 / 843516 AraportID:AT1G71860 Length:340 Species:Arabidopsis thaliana


Alignment Length:298 Identity:73/298 - (24%)
Similarity:125/298 - (41%) Gaps:85/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1134 DKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVR-GPRDAPNYYIACQAPLESTTSDFWRMIW 1197
            :||||::|:|..:.|:||....|.....|:||:.:: ...::.:.:||.|.||..|..|||.|:.
plant    89 EKNRYSDVVPFDKNRIVLNPCKDSSAKGYVNASLIKTSESESISQFIATQGPLPHTMEDFWEMVI 153

  Fly  1198 EQQSRVIIQATDLSENG-IERCAEYLPPSATLDNHSSYGDYQVTLKHREVKDRYAISTLVLKRVD 1261
            :|...:|:..|.|.:|. ..:|.:|....   |....:|:..:|.|..:..|    ::|:|:.::
plant   154 QQHCPIIVMLTRLVDNNRTVKCGDYFQDE---DGPREFGNISLTTKWIKTTD----TSLMLRNLE 211

  Fly  1262 ------GEESRELTHYWY-KWPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSATLETS 1319
                  .::...:.|..| :||:.|||.:...:                   .|:.::...:..|
plant   212 VNYKETEDQPMSVLHIQYPEWPDHGVPKDTVAV-------------------REILKRLYQVPPS 257

  Fly  1320 MDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGT----------IIASDMA 1374
            :                               ||:.||||.|.|||||          |:|.||:
plant   258 L-------------------------------GPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMS 291

  Fly  1375 IRSLETPKRSVDIPQLVYYVRRGRASAVQTKEQYEFIY 1412
                     ::|:.:.|...|:.|...|||.:||.|.|
plant   292 ---------ALDLAKTVALFRKQRIGMVQTMDQYFFCY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 73/298 (24%)
Y_phosphatase 1134..1415 CDD:278528 73/298 (24%)
PTP1NP_001031266.1 PTPc_plant_PTP1 117..321 CDD:350496 63/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19134
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.