DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and PTPN7

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_011508121.1 Gene:PTPN7 / 5778 HGNCID:9659 Length:511 Species:Homo sapiens


Alignment Length:418 Identity:103/418 - (24%)
Similarity:162/418 - (38%) Gaps:115/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1053 LDAYSLDNVSVLGSVRRKGRDMRASKRTYGNAAFDDPSLRHNLLTASELARFVERRSDVFEEFRD 1117
            ||..||..|..:.||...........||.|:.           ||...|.|.......:.|||..
Human   155 LDVRSLGAVEPICSVNTPREVTLHFLRTAGHP-----------LTRWALQRQPPSPKQLEEEFLK 208

  Fly  1118 VPQIIARADEVP-PGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDAPNYYIAC 1181
            :|......:::. ||...|:||..::|.|::||.|.|....:..:||||||:||.......|||.
Human   209 IPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIAT 273

  Fly  1182 QAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEYLPPSATLDNHSSYGDYQVTLKHREV 1246
            |.|:.:|.||||.|:|:::..:|:..|.|.| |.|:|..|.|     ....:||.:|:.::..:.
Human   274 QGPMPNTVSDFWEMVWQEEVSLIVMLTQLRE-GKEKCVHYWP-----TEEETYGPFQIRIQDMKE 332

  Fly  1247 KDRYAISTLVLKRVDGEESRELTHYWYK-WPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELR 1310
            ...|.:..|.::.  .||.|.:.|..:. ||:...|....|::.::.|..               
Human   333 CPEYTVRQLTIQY--QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVE--------------- 380

  Fly  1311 EKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTIIASDMAI 1375
                             |:..|::|               .||:.||||.|.||||..||:.:..
Human   381 -----------------ESPETAAH---------------PGPIVVHCSAGIGRTGCFIATRIGC 413

  Fly  1376 RSLETPKRSVDIPQLVYYVRRGR------------------------------------------ 1398
            :.|:. :..|||..:|..:|..|                                          
Human   414 QQLKA-RGEVDILGIVCQLRLDRLLERRKLEAQEYSWPDPRLQRSGFVPGAEWIKEDQVSTWGIT 477

  Fly  1399 ----ASAVQTKEQYEFIYKVASMYAAKI 1422
                ...:||.|||:|::...::||.::
Human   478 PQHVGGMIQTAEQYQFLHHTLALYAGQL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 81/327 (25%)
Y_phosphatase 1134..1415 CDD:278528 81/327 (25%)
PTPN7XP_011508121.1 PTPc 201..499 CDD:214550 87/353 (25%)
PTPc 227..499 CDD:238006 81/327 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D566624at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.