DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and PTPN2

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_005258181.1 Gene:PTPN2 / 5771 HGNCID:9650 Length:438 Species:Homo sapiens


Alignment Length:338 Identity:85/338 - (25%)
Similarity:138/338 - (40%) Gaps:87/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1110 DVFEEFRDVPQIIARADEVPPGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDA 1174
            ::..|..|.|..:|:.    |...::|||.:|.|...:||.||...:|    ||||:.| ...:|
Human    24 EIRNESHDYPHRVAKF----PENRNRNRYRDVSPYDHSRVKLQNAEND----YINASLV-DIEEA 79

  Fly  1175 PNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEYLPPSATLDNHSSYGD--Y 1237
            ...||..|.||.:|...||.|:|:|:::.::....:.|....:||:|.|   |.|....:.:  :
Human    80 QRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWP---TDDQEMLFKETGF 141

  Fly  1238 QVTLKHREVKDRYAISTLVLKRVD-----------------------GEESRELTHYWY-KWPEA 1278
            .|.|...:||..|.:..|.|:.::                       ..|:|.::|:.| .||:.
Human   142 SVKLLSEDVKSYYTVHLLQLENINYIENLWITLYLKLLMLDVKRSLKSGETRTISHFHYTTWPDF 206

  Fly  1279 GVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISS 1343
            |||...|..:..|.:.|                                |:||.:          
Human   207 GVPESPASFLNFLFKVR--------------------------------ESGSLN---------- 229

  Fly  1344 RSGTRSQQGPLTVHCSPGTGRTGTIIASDMAIRSLETPKRSVDIPQLVYYVRRGRASAVQTKEQY 1408
                 ...||..:|||.|.||:||....|..:..:|... .::|.|::..:|:.|...:||.:|.
Human   230 -----PDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD-DINIKQVLLNMRKYRMGLIQTPDQL 288

  Fly  1409 EFIYKVASMYAAK 1421
            .|.| :|.:..||
Human   289 RFSY-MAIIEGAK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 77/306 (25%)
Y_phosphatase 1134..1415 CDD:278528 77/306 (25%)
PTPN2XP_005258181.1 PTP_DSP_cys 19..295 CDD:391942 82/331 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.