DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and Ptp61F

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:282 Identity:73/282 - (25%)
Similarity:113/282 - (40%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1136 NRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDAPNYYIACQAPLESTTSDFWRMIWEQQ 1200
            |||.:|.|...:|:||:|    ...:|||||.|:..| |...||..|.||..|...||.|:|||:
  Fly    64 NRYRDVNPYDHSRIVLKR----GSVDYINANLVQLER-AERQYILTQGPLVDTVGHFWLMVWEQK 123

  Fly  1201 SRVIIQATDLSENGIERCAEYLPPSATLDNHSSYGDYQVT--LKHREVKDRYAISTLVLKRVDGE 1263
            ||.::....|.|....:|..|.|.....|........::|  |...|....:......|..::.:
  Fly   124 SRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQ 188

  Fly  1264 ESRELTHYWY-KWPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSATLETSMDADGSKA 1327
            :|||:..:.| .||:.|:|:.....:..|.:.|.                               
  Fly   189 QSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRD------------------------------- 222

  Fly  1328 EAGSTSSHEINGNISSRSGTRSQQ-GPLTVHCSPGTGRTGTIIASDMAIRSLETPKRSVDIPQLV 1391
                             ||..|:. ||..||||.|.||:||....|..:..:: .....::.:::
  Fly   223 -----------------SGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLID-KYGECNVSKVL 269

  Fly  1392 YYVRRGRASAVQTKEQYEFIYK 1413
            ..:|..|...:||.:|.:|.|:
  Fly   270 CELRSYRMGLIQTADQLDFSYQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 73/282 (26%)
Y_phosphatase 1134..1415 CDD:278528 73/282 (26%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 73/282 (26%)
PTPc 62..295 CDD:238006 73/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.