DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and Ptp36E

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster


Alignment Length:383 Identity:94/383 - (24%)
Similarity:155/383 - (40%) Gaps:100/383 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1061 VSVLGS-------VRRKGRDMRAS-KRTYGNAAFDDPSLRHNLLTASELARFVERRSDVFE--EF 1115
            :|:|.|       ::.:.||...| .:|..|...|   :||.|....     :.|:..|..  ||
  Fly    50 LSMLNSGLLSFERIKLEARDENNSLSKTIPNGPID---IRHFLKLCD-----LRRKFPVLYKLEF 106

  Fly  1116 RDVPQIIARADEVPPGCE--------DKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPR 1172
            :...::.:..      |.        :||:....||....||||::.|....::|:||:||    
  Fly   107 QTAAKVESNT------CRHALKKNNLEKNQNPKCIPYDYNRVVLEKVGGLQDSDYVNASYV---- 161

  Fly  1173 DA---PNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEYLPPSATLDNHSSY 1234
            |:   ||.||..|.|:|.|...:|||:|::....|:..|...:.....|.:|.||:  ::.|..|
  Fly   162 DSLLKPNAYIVTQGPVEETVQAYWRMVWQENISAIVMLTKTFDFAKVMCHQYWPPN--MEVHEQY 224

  Fly  1235 GDYQVTLKHREVKDRYAISTLVLKRVDGEESRELT--------HY--WYKWPEAGVPAEEAPIIA 1289
            ||..:.:...|....:.|.|..|.:::  |.:|:|        ||  ||        :...|...
  Fly   225 GDIFINIVREEQLANFHIRTFRLYKMN--EKQEVTDERLILQFHYTEWY--------SHSCPFSN 279

  Fly  1290 MLLEARSSLKSYSLEQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPL 1354
            .|||.|..::   |...|.::::.                                   ..:||:
  Fly   280 ALLEFRRRVR---LVVGNIIKDED-----------------------------------DMRGPI 306

  Fly  1355 TVHCSPGTGRTGTIIASDMAIRSLETPKRSVDIPQLVYYVRRGRASAVQTKEQYEFIY 1412
            .||||.|.||:|..::.| |...|...:...::...:..:|:.|...|:..|||:|||
  Fly   307 LVHCSDGGGRSGVYMSID-ANLELAEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIY 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 77/292 (26%)
Y_phosphatase 1134..1415 CDD:278528 77/292 (26%)
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 77/294 (26%)
Y_phosphatase 428..671 CDD:395053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.