DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and Ptpn22

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001099930.1 Gene:Ptpn22 / 295338 RGDID:1307992 Length:804 Species:Rattus norvegicus


Alignment Length:377 Identity:96/377 - (25%)
Similarity:159/377 - (42%) Gaps:82/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 LDNVSVLGSVRRKGRDMRASKRTYGNAAFDDPSLRHNLLTASELARFVERRSDVFEEFRDVPQII 1122
            :|...:|..:.::.:..:.::..:.|                |..: ::|:|..::..:..|..:
  Rat     1 MDQREILQQLLKEAQKKKINREEFAN----------------EFLK-LKRQSTKYKADKIYPTTV 48

  Fly  1123 ARADEVPPGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDAPNYYIACQAPLES 1187
            |:.    |....||||.:::|...:.|.|.....|:.:.||||::::|.. .|..|||.|.||.:
  Rat    49 AQR----PKNIKKNRYKDILPYDHSLVELSLLTSDEDSSYINASFIKGVY-GPRAYIATQGPLST 108

  Fly  1188 TTSDFWRMIWEQQSRVIIQATDLSENGIERCAEY-LPPSATLDNHSSYGDYQVTLKHREVKDRYA 1251
            |..||||||||.:..||:.|....|.|.::|..| ..|..|   ...:|.:.::.:..:.|..|.
  Rat   109 TLLDFWRMIWEYRVLVIVMACMEFEMGKKKCERYWAEPGET---QLQFGPFSISCETEKKKSDYK 170

  Fly  1252 ISTLVLKRVDGEESRELTHYWYK-WPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSAT 1315
            |.|  ||.....|:|.:..:.|| ||:..||:...||:.::.:.|.            .:|....
  Rat   171 IRT--LKAKFNSETRIVYQFHYKNWPDHDVPSSIDPILQLIWDMRC------------YQEDDCV 221

  Fly  1316 LETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTIIASD---MAIRS 1377
                                                 ||.:|||.|.||||.|.|.|   |.::.
  Rat   222 -------------------------------------PLCIHCSAGCGRTGVICAVDYTWMLLKD 249

  Fly  1378 LETPKRSVDIPQLVYYVRRGRASAVQTKEQYEFIYKVASMYAAKITNLSNDN 1429
            ...|| :..:..|:..:|..|.|.|||:||||.:|........:..::.:||
  Rat   250 GIIPK-NFSVFNLIQEMRTQRPSLVQTQEQYELVYSAVLELFKRHVDIISDN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 85/285 (30%)
Y_phosphatase 1134..1415 CDD:278528 85/285 (30%)
Ptpn22NP_001099930.1 PTPc 24..288 CDD:214550 92/340 (27%)
PTPc 56..288 CDD:238006 85/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.