DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and PTPN18

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_006712480.1 Gene:PTPN18 / 26469 HGNCID:9649 Length:464 Species:Homo sapiens


Alignment Length:333 Identity:103/333 - (30%)
Similarity:148/333 - (44%) Gaps:81/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1114 EFRDVPQIIA--RADEV-------PPGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVR 1169
            ||.|:....|  :||.|       .|....||||.:|:|..:|||:|....::..::|||.|::|
Human    29 EFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKDVLPYDQTRVILSLLQEEGHSDYINGNFIR 93

  Fly  1170 GPRDAPNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEY----LPPSATLDN 1230
            |. |....|||.|.||..|..||||::||...:||:.|....|||.:||..|    ..|..|   
Human    94 GV-DGSLAYIATQGPLPHTLLDFWRLVWEFGVKVILMACREIENGRKRCERYWAQEQEPLQT--- 154

  Fly  1231 HSSYGDYQVTLKHREVKDRYAISTLVLKRVD---GEESRELTHYWY-KWPEAGVPAEEAPIIAML 1291
                |.:.:||    :|:::....::|:.:.   .:|||.:....| .||:.|||:....::||:
Human   155 ----GLFCITL----IKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMV 211

  Fly  1292 LEARSSLKSYSLEQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTV 1356
            .|||.                         ..||..|                        ||.|
Human   212 EEARR-------------------------LQGSGPE------------------------PLCV 227

  Fly  1357 HCSPGTGRTGTIIASDMAIRSLETPKRSVDIP--QLVYYVRRGRASAVQTKEQYEFIY-KVASMY 1418
            |||.|.||||.:...|...:.|.|.....|..  .:|..:|:.|.:||||:|||.|:| .||.|:
Human   228 HCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMF 292

  Fly  1419 AAKITNLS 1426
            .:.:.|.|
Human   293 CSTLQNAS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 90/291 (31%)
Y_phosphatase 1134..1415 CDD:278528 90/291 (31%)
PTPN18XP_006712480.1 Y_phosphatase 56..290 CDD:278528 91/294 (31%)
PTPc 59..290 CDD:238006 91/291 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.