DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42327 and Ptpn7

DIOPT Version :9

Sequence 1:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_006249882.1 Gene:Ptpn7 / 246781 RGDID:708516 Length:405 Species:Rattus norvegicus


Alignment Length:376 Identity:102/376 - (27%)
Similarity:165/376 - (43%) Gaps:78/376 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1053 LDAYSLDNVSVLGSVRRKGRDMRASKRTYGNAAFDDP----SLRHNLLTASELARFVERRSDVFE 1113
            ||..||..|..:.||...........||.|:     |    :|:|...:..:|.          |
  Rat    96 LDVRSLGTVEPICSVNTPREVTLHFLRTAGH-----PLTRWTLQHQPPSPKQLE----------E 145

  Fly  1114 EFRDVPQIIARADEVP-PGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDAPNY 1177
            ||..:|......:::. ||...|:||..::|.|::||.|.|....:.::||||||:||.......
  Rat   146 EFLKIPSNFVNPEDLDIPGHASKDRYKTILPNPQSRVCLGRAHSQEDSDYINANYIRGYDGKEKV 210

  Fly  1178 YIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEYLPPSATLDNHSSYGDYQVTLK 1242
            |||.|.|:.:|.:|||.|:|::...:|:..|.|.| |.|:|..|.|     ....:||.:|:.::
  Rat   211 YIATQGPMPNTVADFWEMVWQEDVSLIVMLTQLRE-GKEKCVHYWP-----TEEEAYGPFQIRIQ 269

  Fly  1243 HREVKDRYAISTLVLKRVDGEESRELTHYWYK-WPEAGVPAEEAPIIAMLLEARSSLKSYSLEQA 1306
            ..:....|.:..|.::.  .:|.|.:.|..:. ||:...|....|::.::.|..           
  Rat   270 GMKEHPEYTVRHLTIQH--QQECRSVKHILFSAWPDHQTPESAGPLLRLVAEVE----------- 321

  Fly  1307 NELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTIIAS 1371
                    |.||:                             :..||:.||||.|.||||..||:
  Rat   322 --------TPETA-----------------------------ANSGPIVVHCSAGIGRTGCFIAT 349

  Fly  1372 DMAIRSLETPKRSVDIPQLVYYVRRGRASAVQTKEQYEFIYKVASMYAAKI 1422
            .:..:.|:. :..|||..:|..:|..|...:||.|||:|::...::|||::
  Rat   350 RIGCQQLKA-RGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAAQL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 79/281 (28%)
Y_phosphatase 1134..1415 CDD:278528 79/281 (28%)
Ptpn7XP_006249882.1 PTPc 142..393 CDD:214550 86/317 (27%)
PTPc 168..393 CDD:238006 79/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D566624at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.